PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008241583.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family B3
Protein Properties Length: 219aa    MW: 25357.3 Da    PI: 8.299
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008241583.2genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B354.32.4e-1737131199
                     EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvk 95 
                     ffk+ ++ ++++ + l++pkkf+ ++g +  +++ l l + +g  W+v l  r+ +g +++ kGW +F +   L+ g  +vF ++g+s+f   v 
  XP_008241583.2  37 FFKIILNGNTSSDAKLRIPKKFVMKYGDDLSNPVSLELLSGNGSAWKVDL--RRLDGDVWFDKGWANFFEFYSLDRGHWLVFGYQGNSKF--QVC 127
                     89999999******************8888899*****************..**********************************9999..999 PP

                     EE-S CS
              B3  96 vfrk 99 
                     +f++
  XP_008241583.2 128 IFDR 131
                     9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-2230133IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.12E-2230132IPR015300DNA-binding pseudobarrel domain
CDDcd100171.71E-1835130No hitNo description
SMARTSM010194.4E-1137132IPR003340B3 DNA binding domain
PROSITE profilePS5086313.70437132IPR003340B3 DNA binding domain
PfamPF023621.1E-1437131IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MNYFQSFEIR YHRSSAIASL PQEIDDWPTF SPTTPHFFKI ILNGNTSSDA KLRIPKKFVM  60
KYGDDLSNPV SLELLSGNGS AWKVDLRRLD GDVWFDKGWA NFFEFYSLDR GHWLVFGYQG  120
NSKFQVCIFD RTCIEVDYPL RKQKMEETDD TDDDFHEDSS DDSVKEQPDD STCPRKTRKK  180
SSLPCPRPQK KNRTSSRGKY GYPAKLGSGI TSSTRRFEK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241583.11e-116PREDICTED: B3 domain-containing protein At1g49475-like
TrEMBLM5VY823e-79M5VY82_PRUPE; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-22B3 family protein